PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P18860_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 286aa    MW: 32417.3 Da    PI: 6.1109
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P18860_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1786138456
                             -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             + +++ eq+++Le+ Fe  +++  e++ +LA+ lgL  rqV +WFqNrRa++k
  GSMUA_Achr10P18860_001  86 KKRLNIEQVRTLERNFELGNKLEPERKMQLARALGLRPRQVAIWFQNRRARWK 138
                             4568889*********************************************9 PP

2HD-ZIP_I/II128.52.9e-4184174191
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             ekk+rl+ eqv++LE++Fe  +kLeperK++lar+Lgl+prqva+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+ene+L++++++L
  GSMUA_Achr10P18860_001  84 EKKKRLNIEQVRTLERNFELGNKLEPERKMQLARALGLRPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFEAIKTENEALQSQNKKL 170
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reel 91 
                             r+e+
  GSMUA_Achr10P18860_001 171 RAEI 174
                             *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1861141IPR009057Homeodomain-like
SuperFamilySSF466894.19E-1976142IPR009057Homeodomain-like
PROSITE profilePS5007116.76380140IPR001356Homeobox domain
SMARTSM003891.2E-1583144IPR001356Homeobox domain
CDDcd000868.13E-1585141No hitNo description
PfamPF000466.1E-1586138IPR001356Homeobox domain
PRINTSPR000311.1E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5120136IPR000047Helix-turn-helix motif
PfamPF021831.2E-13140176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MACNGMASSS SFPSNFMFHT ETPYEEGNQL TAPLGSLLHT GPQDLRGGVA PVMGKRSISF  60
PGIESCEEMN ADDDLSDDGW QAGEKKKRLN IEQVRTLERN FELGNKLEPE RKMQLARALG  120
LRPRQVAIWF QNRRARWKTK QLEKDYDVLK RQFEAIKTEN EALQSQNKKL RAEILAFRGT  180
ETSDMINLNK ETEGSCSNRS ENSSEINIDI SRTSVIESSL PPHQILPYFP SIRPADINQL  240
LHNSCKPEFQ CAKVENEAPE VSFSNLLGSM GDQSALWSWP DHHHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380171.10.0PREDICTED: homeobox-leucine zipper protein HOX21-like isoform X1
SwissprotQ8S7W96e-91HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLM0RJG10.0M0RJG1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P18860_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-74HD-ZIP family protein